General Information

  • ID:  hor000033
  • Uniprot ID:  O44665
  • Protein name:  Neuropeptide-like protein 30
  • Gene name:  nlp-28
  • Organism:  Caenorhabditis elegans
  • Family:  YARP (YGGW-amide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QWGYGGYGRGYGGYGGYGRGYGGYGRGYGGYGRGMWGRPYGGYGWGK
  • Length:  47
  • Propeptide:  MISTSSILILVVLLACFMAASAQWGYGGYGRGYGGYGGYGRGYGGYGRGYGGYGRGMWGRPYGGYGWGK
  • Signal peptide:  MISTSSILILVFLLACFMATSA
  • Modification:  T7 Tyrosine amide;T17 Tyrosine amide;T25 Tyrosine amide;T33 Tyrosine amide;T41 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have antimicrobial activity. May play a role in response to fungal infection.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44665-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000033_AF2.pdbhor000033_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 582704 Formula: C231H299N67O60S
Absent amino acids: ACDEFHILNSTV Common amino acids: G
pI: 10 Basic residues: 6
Polar residues: 35 Hydrophobic residues: 3
Hydrophobicity: -119.57 Boman Index: -5533
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: -2132.13 Extinction Coefficient cystines: 32890
Absorbance 280nm: 715

Literature

  • PubMed ID:  NA
  • Title:  NA